Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G145500.1.p
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family HD-ZIP
Protein Properties Length: 809aa    MW: 88726.8 Da    PI: 6.3516
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G145500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          ++k +++t++q++eLe++F+++++p++++r eL+++lgL+ +q+k+WFqNrR+++k
                          79999************************************************999 PP

                START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                          la++a++el+k a+ ++p+W+++    + ++ +e++++f++  +     + +ea r++g+v+ ++  l e+l+d++ +W e ++    ka
                          6899*********************9999***********99889***99**************************.************* PP

                START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                          +t++vissg      galqlm ae+q++sp vp R + f+R+++q+ +g+w++vdvS+d +q+ ++s+s++ ++++pSg+++++++ng s
                          ****************************************************************************************** PP

                START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +vtwveh +++++ +h+l+rs+++sgla+ga++wvatlqr+ce+
                          ******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.848109169IPR001356Homeobox domain
SMARTSM003894.3E-18111173IPR001356Homeobox domain
PfamPF000461.3E-18112167IPR001356Homeobox domain
CDDcd000861.89E-19112169No hitNo description
PROSITE patternPS000270144167IPR017970Homeobox, conserved site
PROSITE profilePS5084841.388307542IPR002913START domain
SuperFamilySSF559613.96E-29308539No hitNo description
CDDcd088751.17E-113311538No hitNo description
SMARTSM002342.9E-44316539IPR002913START domain
PfamPF018525.5E-53317539IPR002913START domain
SuperFamilySSF559611.65E-19567802No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090292.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_002510822.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLB9R9E70.0B9R9E7_RICCO; Homeobox protein, putative
STRINGPOPTR_0015s13340.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein